Live prices from 21 SA suppliers, from R250.00, compared side by side so you never overpay.
Copy the code — you'll paste it at checkout.
with our exclusive code
You're about to visit an external supplier
with our exclusive code
By clicking "Continue", you acknowledge that you understand and accept the above. Read our full disclosure.
Compare 34 prices for Tirzepatide. Cheapest: R250.00. Average: R1,739.74.
| Compare | Visit | |||||||
|---|---|---|---|---|---|---|---|---|
|
Crono Pharm
Best
Tirzepatide 30mg |
R250.00 | R8.33/mg | In Stock | R150.00 |
Lab Tested
|
— | ||
|
Tirzepatide 30mg |
R895.00 | R29.83/mg | In Stock | Free over R1,500 |
Lab Tested
|
— | ||
|
Tirzepatide 30mg |
R950.00 | R31.67/mg | In Stock | Free over R4,000 |
—
|
— | ||
|
Tirzepatide 30mg |
R1,100.00 | R36.67/mg | In Stock | R120.00 |
—
|
— | ||
|
Tirzepatide |
R1,300.00 | R43.33/mg | In Stock | Free over R2,500 |
Lab Tested
|
— | ||
|
Tirzepatide |
R1,399.00 | R46.63/mg | In Stock | Free |
Lab Tested
|
— | ||
|
Tirzepatide 30mg |
R1,400.00 | R46.67/mg | In Stock | R170.00 |
—
|
— | ||
|
Tirzepatide Pen |
R1,400.00 | R46.67/mg | In Stock | R150.00 |
Lab Tested
|
— | ||
|
Tirzepatide 30mg |
R1,440.00 | R48.00/mg | In Stock | R160.00 |
—
|
— | ||
|
Tirzepatide 30mg |
R1,450.00 | R48.33/mg | In Stock | R170.00 |
—
|
— | ||
|
Tirzepatide 30mg |
R1,500.00 | R50.00/mg | In Stock | R150.00 |
Lab Tested
|
— | ||
|
Tirzepatide Pen |
R1,549.00 | R51.63/mg | In Stock | Free |
Lab Tested
|
— | ||
|
Tirzepatide 30mg |
R1,550.00 | R51.67/mg | In Stock | R160.00 |
—
|
— | ||
|
Tirzepatide 30mg |
R1,600.00 | R53.33/mg | In Stock | R250.00 |
—
|
— | Unavailable | |
|
Tirzepatide 30mg |
R1,650.00 | R55.00/mg | In Stock | Free over R1,200 |
—
|
— | ||
|
Tirzepatide 30mg |
R1,670.00 | R55.67/mg | In Stock | R160.00 |
—
|
— | ||
|
Tirzepatide 30mg |
R1,700.00 | R56.67/mg | In Stock | R170.00 |
—
|
— | ||
|
Tirzepatide 30mg |
R1,730.00 | R57.67/mg | In Stock | R160.00 |
—
|
— | ||
|
Tirzepatide 30mg |
R1,750.00 | R58.33/mg | In Stock | R250.00 |
—
|
— | Unavailable | |
|
Tirzepatide Pen |
R1,810.00 | R60.33/mg | In Stock | R225.00 |
Lab Tested
|
— | ||
|
Tirzepatide Pen |
R1,850.00 | R61.67/mg | In Stock | R100.00 |
—
|
— | ||
|
Tirzepatide 30mg |
R1,850.00 | R61.67/mg | In Stock | R100.00 |
—
|
— | ||
|
Tirzepatide 30mg |
R1,900.00 | R63.33/mg | In Stock | R170.00 |
—
|
— | ||
|
Tirzepatide 30mg |
R1,950.00 | R65.00/mg | In Stock | R250.00 |
—
|
— | ||
|
Tirzepatide 30mg |
R2,000.00 | R66.67/mg | In Stock | R200.00 |
—
|
— |
Showing 25 of 33 listings
More ways to compare Tirzepatide
Different views of the same live SA pricing, tuned for how you like to shop.
Compare another peptide
All purchases are made directly from third-party suppliers; your relationship is solely with them. We accept no liability for the quality, purity, or legality of any products listed.
We may earn a commission when you click through to a supplier and make a purchase. This does not affect pricing information displayed.
By using this site you accept responsibility for ensuring purchases comply with applicable laws in your jurisdiction. Read our full disclosure.
Dual GIP/GLP-1 Receptor Agonist | Weight Loss & Diabetes
Revolutionary dual receptor agonist FDA-approved for type 2 diabetes and chronic weight management. Demonstrates efficacy superior to single-mechanism alternatives with 15-22% body weight reduction in clinical trials. The first-in-class dual GIP/GLP-1 agonist provides enhanced metabolic benefits compared to GLP-1-only medications.
Dual agonist targeting both GIP and GLP-1 receptors, producing glucose-dependent insulin stimulation, delayed gastric emptying, glucagon suppression, and central satiety signaling via hypothalamic pathways.
HUEGTFTSDVSSYLEGQAAKEFIAWLVRGRGGGGGPSKKKKKK
Histidine
Position 1
Aminoisobutyric Acid
Position 2
Glutamic Acid
Position 3
Glycine
Position 4
Threonine
Position 5
Phenylalanine
Position 6
Threonine
Position 7
Serine
Position 8
Aspartic Acid
Position 9
Valine
Position 10
Serine
Position 11
Serine
Position 12
Tyrosine
Position 13
Leucine
Position 14
Glutamic Acid
Position 15
Glycine
Position 16
Glutamine
Position 17
Alanine
Position 18
Alanine
Position 19
Lysine
Position 20
Glutamic Acid
Position 21
Phenylalanine
Position 22
Isoleucine
Position 23
Alanine
Position 24
Tryptophan
Position 25
Leucine
Position 26
Valine
Position 27
Arginine
Position 28
Glycine
Position 29
Arginine
Position 30
Glycine
Position 31
Glycine
Position 32
Glycine
Position 33
Glycine
Position 34
Glycine
Position 35
Proline
Position 36
Serine
Position 37
Lysine
Position 38
Lysine
Position 39
Lysine
Position 40
Lysine
Position 41
Lysine
Position 42
Lysine
Position 43
Clinical trials demonstrate 15-22% body weight reduction in non-diabetic obese individuals, superior to existing weight loss medications.
Improvements in waist circumference, blood pressure, triglycerides, HDL cholesterol, and insulin resistance markers.
Preferentially reduces visceral adipose tissue while preserving lean muscle mass with resistance training.
Superior HbA1c reduction of 1.5-2.4% in clinical trials.
Improves insulin sensitivity across diverse populations.
May help preserve and restore pancreatic beta cell function.
26% reduction in major adverse cardiovascular events demonstrated in SURPASS-CVOT trial.
Systolic and diastolic blood pressure reductions of 8-12 mmHg.
Triglyceride improvements of 20-30%, HDL enhancement, and apolipoprotein B reduction.
Once-weekly subcutaneous injection. Can be taken any time of day, with or without food. Injection sites include thigh, abdomen (2+ inches from navel), or upper arm.
| Goal | Dose | Frequency | Route |
|---|---|---|---|
| Weight loss initiation | 2.5mg | Once weekly x 4 weeks | SubQ injection |
| Weight loss progression | 5mg | Once weekly | SubQ injection |
| Weight loss optimization | 7.5-10mg | Once weekly | SubQ injection |
| Maximum weight loss | 12.5-15mg | Once weekly | SubQ injection |
| Diabetes management (mild) | 5-7.5mg | Once weekly | SubQ injection |
| Diabetes management (severe) | 10-15mg | Once weekly | SubQ injection |
Both are GLP-1 agonists—combining increases hypoglycemia and severe GI side effect risk.
Another GLP-1 agonist—dual therapy contraindicated due to additive effects.
May require significant insulin dose reduction due to improved sensitivity.
Complementary mechanisms for diabetes management and weight loss.
Growth hormone support may help preserve muscle mass during weight loss.
May help maintain metabolic rate and muscle preservation.
No known interactions, may support gut health and reduce GI effects.
NNMT inhibition may complement GLP-1 effects for metabolic optimization.
Appetite reduction begins
Improved blood sugar control (diabetics), mild nausea common
Initial weight loss begins; GI side effects typically improve
1-3 lbs weight loss per week during active phase
Peak weight loss effects observed
15mg weekly achieved 22.5% weight loss vs 2.4% placebo over 72 weeks—largest weight loss in pharmaceutical trials.
Superior HbA1c reduction and weight loss compared to insulin, semaglutide, and existing diabetes medications.
15mg dose achieved 15.7% weight loss with significant cardiometabolic improvements over 72 weeks.
26% reduction in major adverse cardiovascular events, establishing cardioprotective benefits.
Be the first to know when prices drop on your favourite peptides
No spam. Unsubscribe anytime. We respect your privacy.