Live prices from 32 SA suppliers, from R310.00, compared side by side so you never overpay.
Copy the code — you'll paste it at checkout.
with our exclusive code
You're about to visit an external supplier
with our exclusive code
By clicking "Continue", you acknowledge that you understand and accept the above. Read our full disclosure.
Compare 3 prices for TB-500. Cheapest: R330.00. Average: R330.00.
| Compare | Visit | |||||||
|---|---|---|---|---|---|---|---|---|
Blaque Sigma
Best
TB-500 2mg |
R330.00 | R165.00/mg | In Stock | R150.00 |
Lab Tested
|
— | ||
|
TB-500 2mg |
R330.00 | R165.00/mg | In Stock | R140.00 |
—
|
— | ||
|
TB-500 2mg |
R330.00 | R165.00/mg | In Stock | R250.00 |
—
|
— |
More ways to compare TB-500
Different views of the same live SA pricing, tuned for how you like to shop.
Compare another peptide
All purchases are made directly from third-party suppliers; your relationship is solely with them. We accept no liability for the quality, purity, or legality of any products listed.
We may earn a commission when you click through to a supplier and make a purchase. This does not affect pricing information displayed.
By using this site you accept responsibility for ensuring purchases comply with applicable laws in your jurisdiction. Read our full disclosure.
Synthetic Fragment (17-23) of Thymosin Beta-4
A synthetic 7-amino acid fragment corresponding to the actin-binding region of thymosin beta-4, originally developed for equine use with retained tissue repair properties. TB-500 acts as principal actin-sequestering protein, regulating cell migration, promoting angiogenesis, reducing inflammation, and activating stem cell differentiation.
Acts as principal actin-sequestering protein, regulating cell migration, promoting angiogenesis, reducing inflammation, and activating stem cell differentiation for comprehensive regenerative effects.
?SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
Ac
Position 1
Serine
Position 2
Aspartic Acid
Position 3
Lysine
Position 4
Proline
Position 5
Aspartic Acid
Position 6
Methionine
Position 7
Alanine
Position 8
Glutamic Acid
Position 9
Isoleucine
Position 10
Glutamic Acid
Position 11
Lysine
Position 12
Phenylalanine
Position 13
Aspartic Acid
Position 14
Lysine
Position 15
Serine
Position 16
Lysine
Position 17
Leucine
Position 18
Lysine
Position 19
Lysine
Position 20
Threonine
Position 21
Glutamic Acid
Position 22
Threonine
Position 23
Glutamine
Position 24
Glutamic Acid
Position 25
Lysine
Position 26
Asparagine
Position 27
Proline
Position 28
Leucine
Position 29
Proline
Position 30
Serine
Position 31
Lysine
Position 32
Glutamic Acid
Position 33
Threonine
Position 34
Isoleucine
Position 35
Glutamic Acid
Position 36
Glutamine
Position 37
Glutamic Acid
Position 38
Lysine
Position 39
Glutamine
Position 40
Alanine
Position 41
Glycine
Position 42
Glutamic Acid
Position 43
Serine
Position 44
Accelerated healing of muscle fibers with reduced recovery time and enhanced repair via cell migration and differentiation.
Connective tissue repair with reduced scar formation and improved biomechanical properties of healing tissues.
Enhanced dermal closure, improved angiogenesis, and reduced inflammation in acute and chronic scenarios.
Faster recovery from intense training with reduced muscle soreness and improved tissue repair.
Strengthened tissues through enhanced repair mechanisms may reduce injury risk.
Improved muscle quality through enhanced regeneration and repair pathways.
Protective effects against neuronal damage in various models.
Preclinical evidence for improved outcomes in spinal injury models.
Potential neuroprotective and regenerative effects on brain tissue.
Subcutaneous or intramuscular injection. Flexible timing with no empty stomach requirement. Can be injected near injury site for localized effect.
| Goal | Dose | Frequency | Route |
|---|---|---|---|
| General tissue repair | 2-3mg | 2x weekly | SubQ or IM |
| Serious injury recovery | 4-5mg | 3x weekly | SubQ near injury site |
| Athletic enhancement | 2-3mg | 2x weekly | SubQ |
| Chronic conditions | 3-4mg | 2-3x weekly | SubQ or IM |
| Maintenance | 2mg | 1-2x weekly | SubQ |
| Post-surgical recovery | 3-5mg | 3x weekly | SubQ |
Topical formulations available for specific applications including wound healing and eye conditions.
| Goal | Dose | Frequency | Route |
|---|---|---|---|
| Chronic wound healing | 0.01-0.03% concentration | 1-2x daily | Topical application |
| Dry eye treatment | Eye drops formulation | As directed | Ophthalmic |
Complementary healing mechanisms with enhanced tissue repair when combined (Wolverine Stack).
May enhance tissue sensitivity to growth hormone effects.
Combined tissue repair with GH-releasing effects for comprehensive recovery.
Enhanced muscle and tissue regeneration through complementary growth pathways.
No negative interactions; potential enhanced recovery.
Different receptor families with no pathway overlap.
Reduced inflammation and improved tissue sensation
Accelerated healing rate and improved tissue quality
Maximum tissue repair and regenerative benefits
Continued improvement in tissue strength and function
Journal of Chromatography B
Analysis of TB-500 metabolic pathways and bioavailability in human subjects for clinical dosing protocols.
Cells Journal
Review of TB-500's ability to reactivate embryonic developmental processes in adult organs for regenerative medicine.
Significant acceleration in wound healing rates in patients with chronic pressure ulcers and venous stasis ulcers compared to placebo in Phase 2 human trial.
TB-500 pre-treated endothelial cells improved left ventricular function by greater than 50% in post-MI subjects in human clinical trial.
Improved skeletal muscle fiber regeneration in dystrophin-deficient mice, showing potential for muscular dystrophy treatment.
Topical TB-500 significantly improved signs and symptoms of moderate to severe dry eye with lasting effects in Phase 2 human trial.
Plain-English guides and study summaries from published literature.
Be the first to know when prices drop on your favourite peptides
No spam. Unsubscribe anytime. We respect your privacy.
