Live prices from 29 SA suppliers, from R355.00, compared side by side so you never overpay.
Copy the code — you'll paste it at checkout.
with our exclusive code
You're about to visit an external supplier
with our exclusive code
By clicking "Continue", you acknowledge that you understand and accept the above. Read our full disclosure.
Try removing a filter or two to widen the search.
Try removing a filter or two to widen the search.
More ways to compare Retatrutide
Different views of the same live SA pricing, tuned for how you like to shop.
Compare another peptide
All purchases are made directly from third-party suppliers; your relationship is solely with them. We accept no liability for the quality, purity, or legality of any products listed.
We may earn a commission when you click through to a supplier and make a purchase. This does not affect pricing information displayed.
By using this site you accept responsibility for ensuring purchases comply with applicable laws in your jurisdiction. Read our full disclosure.
Triple GLP-1/GIP/Glucagon Agonist | Weight Loss & Diabetes
Novel triple hormone receptor agonist targeting GLP-1, GIP, and glucagon receptors. Phase II trials demonstrated 24.2% weight loss at 48 weeks—the highest recorded for obesity medications.
Activates GLP-1 for appetite suppression, GIP for insulin sensitivity, and glucagon for increased energy expenditure and hepatic fat oxidation.
HUEGTFTSDVSSYLEGQAAKEFIAWLVRGRGPSSGAPPPS
Histidine
Position 1
Aminoisobutyric Acid
Position 2
Glutamic Acid
Position 3
Glycine
Position 4
Threonine
Position 5
Phenylalanine
Position 6
Threonine
Position 7
Serine
Position 8
Aspartic Acid
Position 9
Valine
Position 10
Serine
Position 11
Serine
Position 12
Tyrosine
Position 13
Leucine
Position 14
Glutamic Acid
Position 15
Glycine
Position 16
Glutamine
Position 17
Alanine
Position 18
Alanine
Position 19
Lysine
Position 20
Glutamic Acid
Position 21
Phenylalanine
Position 22
Isoleucine
Position 23
Alanine
Position 24
Tryptophan
Position 25
Leucine
Position 26
Valine
Position 27
Arginine
Position 28
Glycine
Position 29
Arginine
Position 30
Glycine
Position 31
Proline
Position 32
Serine
Position 33
Serine
Position 34
Glycine
Position 35
Alanine
Position 36
Proline
Position 37
Proline
Position 38
Proline
Position 39
Serine
Position 40
Clinical trials show 17.5% weight loss at 24 weeks and 24.2% at 48 weeks.
Continuous weight loss with no plateau at 48 weeks suggests greater long-term potential.
Addresses obesity through appetite suppression, energy expenditure, and metabolic efficiency.
HbA1c reductions up to 2.16% with 82% achieving target levels below 6.5%.
Balanced glycemic control with minimal hypoglycemia risk.
Marked improvements in sensitivity with potential for reduced exogenous insulin requirements.
Non-HDL cholesterol reductions up to 26.9%, triglyceride reductions up to 40.6%.
Consistent decreases in systolic and diastolic blood pressure across trials.
Up to 82% reduction in liver fat with normalization in 90% of participants.
Weekly subcutaneous injection into abdomen, thigh, or upper arm with site rotation.
| Goal | Dose | Frequency | Route |
|---|---|---|---|
| Starting Dose (Week 1-4) | 0.5mg | Once weekly | SubQ |
| Low Maintenance (Week 4-8) | 1mg | Once weekly | SubQ |
| Escalation (Week 8-12) | 2mg | Once weekly | SubQ |
| Moderate (Week 12-16) | 4mg | Once weekly | SubQ |
| Advanced (Week 16-20) | 8mg | Once weekly | SubQ |
| Maximum Efficacy (Week 20+) | 12mg | Once weekly | SubQ |
Do not combine with other dual/triple agonists—risk of severe hypoglycemia and excessive GI effects.
Do not combine—overlapping GLP-1 agonist mechanisms increase severe hypoglycemia risk.
Both cause significant GI effects. Not recommended without specialist supervision.
May significantly reduce insulin requirements. Monitor blood glucose and adjust insulin doses accordingly.
Safe combination tested in clinical trials. Different mechanisms work complementarily for glucose control.
Clinical trials included SGLT2 inhibitors with no safety concerns.
Safe combination; BPC-157 may provide GI protective benefits during retatrutide use.
Space oral contraceptives by 1 hour before retatrutide due to delayed gastric emptying.
Initial appetite suppression and mild GI effects as body adapts to triple hormone activation
Noticeable food cravings reduction and portion size decrease; early weight loss (2-5%)
Significant appetite control and steady weight loss (5-10%); improved glucose control
Substantial weight reduction (10-18%) with enhanced energy expenditure
Major weight loss milestone (15-22%) with cardiovascular benefits and liver fat reduction
Maximum clinical efficacy (20-24.2%) with comprehensive metabolic improvements
Landmark RCT in 338 participants showing dose-dependent weight loss; 12mg dose achieved 24.2% reduction—highest recorded for any obesity medication. NEJM.
Trial in 281 participants with type 2 diabetes: 16.9% weight loss and HbA1c reductions up to 2.16%. The Lancet.
Metabolic dysfunction-associated steatotic liver disease study: 82% liver fat reduction with normalization in >90% at highest doses. Nature Medicine.
Cryo-EM structures reveal simultaneous activation of GLP-1R, GIPR, and GCGR, explaining superior clinical efficacy. Cell Discovery.
Plain-English guides and study summaries from published literature.
Guides
7 min
A 60mg Retatrutide product contains twice the stated peptide quantity of a 30mg product, but that does not make it twice as effective or automatically better value. Here is how to read the numbers properly.
Read article
Guides
10 min
A research-focused guide to Retatrutide dosing, covering triple agonist effects, slower titration, functional checkpoints and why 12 mg should not be treated as the default target.
Read article
Guides
8 min
Retatrutide is an investigational GLP-1/GIP/glucagon receptor tri-agonist studied for weight management, glycaemic control, liver fat reduction and wider metabolic outcomes.
Read article
Guides
8 min
Retatrutide is a triple GLP-1, GIP and glucagon receptor agonist being studied for weight management, glycaemic control, liver fat and wider metabolic health.
Read article
Guides
7 min
Microdosing Retatrutide is widely discussed, but it is not an established clinical protocol. Here is what low-dose research actually supports, and where the evidence stops.
Read article
Guides
8 min
Retatrutide is best known for major weight-loss results, but research also examines glucose control, liver fat and cardiometabolic markers. The evidence is promising, with important limits.
Read articleBe the first to know when prices drop on your favourite peptides
No spam. Unsubscribe anytime. We respect your privacy.