--- title: "Tirzepatide Peptide SA - Compare Prices from 21 Suppliers - PeptideSupermarket®" description: "Compare Tirzepatide prices from 21 SA suppliers, from R250.00. Find the cheapest deals, read reviews and save money." url: "https://peptidesupermarket.co.za/peptide/tirzepatide" site: "PeptideSupermarket®" country: "South Africa" --- [Home](https://peptidesupermarket.co.za) › [Peptides](https://peptidesupermarket.co.za/compare-peptide-prices-za) › Tirzepatide Search # Tirzepatide Price Comparison Live prices from 21 SA suppliers, from R250.00, compared side by side so you never overpay. [GLP-1 & metabolic research](https://peptidesupermarket.co.za/compare-peptide-prices-za) Prices checked 33 minutes ago We compare prices & may earn a commission. Includes a featured placement — not an endorsement. [Full disclosure](https://peptidesupermarket.co.za/disclosure). Best Price R250.00 Average R1,739.74 Highest R3,659.00 You Could Save 93% 34 results 30mg Featured Supplier [BioHack Peptides](https://peptidesupermarket.co.za/suppliers/biohack-peptides) ★★★★★ [4.9 reviews](https://peptidereview.co.uk/review/biohackpeptides.co.uk) Tirzepatide Out of Stock 30mg Lab Tested R950.00 FREE over R3,000 View Deal Compare 34 prices for Tirzepatide. Cheapest: R250.00. Average: R1,739.74. | Compare | Supplier | Price | Price / mg | Stock | Delivery | Quality | Coupon | Visit | | --- | --- | --- | --- | --- | --- | --- | --- | --- | | | [Crono Pharm](https://peptidesupermarket.co.za/suppliers/chrono-pharm) Best Tirzepatide 30mg | R250.00 | R8.33/mg | In Stock | R150.00 | Lab Tested | — | Visit | | | [Peptide South Africa](https://peptidesupermarket.co.za/suppliers/peptide-south-africa) Tirzepatide 30mg | R895.00 | R29.83/mg | In Stock | Free over R1,500 | Lab Tested | — | Visit | | | [TrueForm](https://peptidesupermarket.co.za/suppliers/trueform) Tirzepatide 30mg | R950.00 | R31.67/mg | In Stock | Free over R4,000 | — | — | Visit | | | [White Rabbit Labs](https://peptidesupermarket.co.za/suppliers/white-rabbit-labs) Tirzepatide 30mg | R1,100.00 | R36.67/mg | In Stock | R120.00 | — | — | Visit | | | [Peak Theory](https://peptidesupermarket.co.za/suppliers/peak-theory) Tirzepatide | R1,300.00 | R43.33/mg | In Stock | Free over R2,500 | Lab Tested | — | Visit | | | [JP Research](https://peptidesupermarket.co.za/suppliers/jp-research) Tirzepatide | R1,399.00 | R46.63/mg | In Stock | Free | Lab Tested | — | Visit | | | [Grow Nova](https://peptidesupermarket.co.za/suppliers/grow-nova) Tirzepatide 30mg | R1,400.00 | R46.67/mg | In Stock | R170.00 | — | — | Visit | | | [Crono Pharm](https://peptidesupermarket.co.za/suppliers/chrono-pharm) Tirzepatide Pen | R1,400.00 | R46.67/mg | In Stock | R150.00 | Lab Tested | — | Visit | | | [Health & Fitness ZA](https://peptidesupermarket.co.za/suppliers/health-fitness-za) Tirzepatide 30mg | R1,440.00 | R48.00/mg | In Stock | R160.00 | — | — | Visit | | | [Grow Nova](https://peptidesupermarket.co.za/suppliers/grow-nova) Tirzepatide 30mg | R1,450.00 | R48.33/mg | In Stock | R170.00 | — | — | Visit | | | [Striata Labs](https://peptidesupermarket.co.za/suppliers/striata-labs) Tirzepatide 30mg | R1,500.00 | R50.00/mg | In Stock | R150.00 | Lab Tested | — | Visit | | | [JP Research](https://peptidesupermarket.co.za/suppliers/jp-research) Tirzepatide Pen | R1,549.00 | R51.63/mg | In Stock | Free | Lab Tested | — | Visit | | | [Health & Fitness ZA](https://peptidesupermarket.co.za/suppliers/health-fitness-za) Tirzepatide 30mg | R1,550.00 | R51.67/mg | In Stock | R160.00 | — | — | Visit | | | [Ignite Muscle](https://peptidesupermarket.co.za/suppliers/ignite-muscle) Tirzepatide 30mg | R1,600.00 | R53.33/mg | In Stock | R250.00 | — | — | Unavailable | | | [ReGen-X](https://peptidesupermarket.co.za/suppliers/regen-x) Tirzepatide 30mg | R1,650.00 | R55.00/mg | In Stock | Free over R1,200 | — | — | Visit | | | [Health & Fitness ZA](https://peptidesupermarket.co.za/suppliers/health-fitness-za) Tirzepatide 30mg | R1,670.00 | R55.67/mg | In Stock | R160.00 | — | — | Visit | | | [Grow Nova](https://peptidesupermarket.co.za/suppliers/grow-nova) Tirzepatide 30mg | R1,700.00 | R56.67/mg | In Stock | R170.00 | — | — | Visit | | | [Health & Fitness ZA](https://peptidesupermarket.co.za/suppliers/health-fitness-za) Tirzepatide 30mg | R1,730.00 | R57.67/mg | In Stock | R160.00 | — | — | Visit | | | [Ignite Muscle](https://peptidesupermarket.co.za/suppliers/ignite-muscle) Tirzepatide 30mg | R1,750.00 | R58.33/mg | In Stock | R250.00 | — | — | Unavailable | | | [Genesis Peptides](https://peptidesupermarket.co.za/suppliers/genesis-peptides) Tirzepatide Pen | R1,810.00 | R60.33/mg | In Stock | R225.00 | Lab Tested | — | Visit | | | [All Peptides](https://peptidesupermarket.co.za/suppliers/all-peptides) Tirzepatide Pen | R1,850.00 | R61.67/mg | In Stock | R100.00 | — | — | Visit | | | [All Peptides](https://peptidesupermarket.co.za/suppliers/all-peptides) Tirzepatide 30mg | R1,850.00 | R61.67/mg | In Stock | R100.00 | — | — | Visit | | | [Grow Nova](https://peptidesupermarket.co.za/suppliers/grow-nova) Tirzepatide 30mg | R1,900.00 | R63.33/mg | In Stock | R170.00 | — | — | Visit | | | [Seranova](https://peptidesupermarket.co.za/suppliers/seranova) Tirzepatide 30mg | R1,950.00 | R65.00/mg | In Stock | R250.00 | — | — | Visit | | | [Pure Peptides SA](https://peptidesupermarket.co.za/suppliers/pure-peptides-sa) Tirzepatide 30mg | R2,000.00 | R66.67/mg | In Stock | R200.00 | — | — | Visit | Showing 25 of 33 listings Show more suppliers Loading More ways to compare Tirzepatide Different views of the same live SA pricing, tuned for how you like to shop. [Best Tirzepatide Prices Best prices ranked](https://peptidesupermarket.co.za/best-tirzepatide-prices) [Cheapest Tirzepatide Prices Cheapest suppliers compared](https://peptidesupermarket.co.za/cheapest-tirzepatide-prices) [Where to Buy Tirzepatide Full buyer's guide](https://peptidesupermarket.co.za/where-to-buy-tirzepatide) [Buy Tirzepatide Online SA Cheap Today's hottest deals](https://peptidesupermarket.co.za/buy-tirzepatide-online-za-cheap) [Tirzepatide Price Comparison Live price dashboard](https://peptidesupermarket.co.za/tirzepatide-price-comparison) [Tirzepatide SA Supplier Verified SA supplier directory](https://peptidesupermarket.co.za/tirzepatide-za-supplier) [Tirzepatide For Sale Browse listings for sale](https://peptidesupermarket.co.za/tirzepatide-for-sale) Compare another peptide Search PeptideSupermarket® compares prices but doesn't sell products. More All purchases are made directly from third-party suppliers; your relationship is solely with them. We accept no liability for the quality, purity, or legality of any products listed. We may earn a commission when you click through to a supplier and make a purchase. This does not affect pricing information displayed. By using this site you accept responsibility for ensuring purchases comply with applicable laws in your jurisdiction. [Read our full disclosure](https://peptidesupermarket.co.za/disclosure). ## Tirzepatide Profile Fda Approved FDA Approved Dual GIP/GLP-1 Receptor Agonist | Weight Loss & Diabetes ### Overview Revolutionary dual receptor agonist FDA-approved for type 2 diabetes and chronic weight management. Demonstrates efficacy superior to single-mechanism alternatives with 15-22% body weight reduction in clinical trials. The first-in-class dual GIP/GLP-1 agonist provides enhanced metabolic benefits compared to GLP-1-only medications. ### Mechanism of Action Dual agonist targeting both GIP and GLP-1 receptors, producing glucose-dependent insulin stimulation, delayed gastric emptying, glucagon suppression, and central satiety signaling via hypothalamic pathways. ### Key Benefits - Dramatic weight loss (15-22% body weight) - Superior diabetes control - Reduced cardiovascular risk (26% reduction in MACE) - Improved insulin sensitivity - Appetite suppression - Preserved muscle mass with exercise ### Quick Stats Typical Dose 2.5mg starting, titrate up to 5-15mg weekly Frequency Once weekly (same day each week) Cycle Duration Ongoing therapy as prescribed Storage Pen: 2-8°C before first use, room temp up to 21 days after. Compounded: 2-8°C ## Molecular Information Molecular Weight 4,813.55 Da Length 39 amino acids Type Dual GLP-1/GIP agonist Half-Life ~5 days (120 hours) ### Amino Acid Sequence One-letter: `HUEGTFTSDVSSYLEGQAAKEFIAWLVRGRGGGGGPSKKKKKK` His 1 Histidine Position 1 Aib 2 Aminoisobutyric Acid Position 2 Glu 3 Glutamic Acid Position 3 Gly 4 Glycine Position 4 Thr 5 Threonine Position 5 Phe 6 Phenylalanine Position 6 Thr 7 Threonine Position 7 Ser 8 Serine Position 8 Asp 9 Aspartic Acid Position 9 Val 10 Valine Position 10 Ser 11 Serine Position 11 Ser 12 Serine Position 12 Tyr 13 Tyrosine Position 13 Leu 14 Leucine Position 14 Glu 15 Glutamic Acid Position 15 Gly 16 Glycine Position 16 Gln 17 Glutamine Position 17 Ala 18 Alanine Position 18 Ala 19 Alanine Position 19 Lys 20 Lysine Position 20 Glu 21 Glutamic Acid Position 21 Phe 22 Phenylalanine Position 22 Ile 23 Isoleucine Position 23 Ala 24 Alanine Position 24 Trp 25 Tryptophan Position 25 Leu 26 Leucine Position 26 Val 27 Valine Position 27 Arg 28 Arginine Position 28 Gly 29 Glycine Position 29 Arg 30 Arginine Position 30 Gly 31 Glycine Position 31 Gly 32 Glycine Position 32 Gly 33 Glycine Position 33 Gly 34 Glycine Position 34 Gly 35 Glycine Position 35 Pro 36 Proline Position 36 Ser 37 Serine Position 37 Lys 38 Lysine Position 38 Lys 39 Lysine Position 39 Lys 40 Lysine Position 40 Lys 41 Lysine Position 41 Lys 42 Lysine Position 42 Lys 43 Lysine Position 43 N-terminus C-terminus Hydrophobic Polar Positive (+) Negative (-) Modified ### Modifications C20 fatty diacid conjugation for albumin binding ## Research Indications The following information is derived from published scientific literature and is provided for educational and research reference purposes only. It does not constitute medical advice, diagnosis, or treatment recommendations. These peptides are not approved for human use and are sold exclusively for in-vitro laboratory research. Weight Loss Diabetes Cardiovascular ## Dosing Protocols ### injectable Once-weekly subcutaneous injection. Can be taken any time of day, with or without food. Injection sites include thigh, abdomen (2+ inches from navel), or upper arm. | Goal | Dose | Frequency | Route | | --- | --- | --- | --- | | Weight loss initiation | 2.5mg | Once weekly x 4 weeks | SubQ injection | | Weight loss progression | 5mg | Once weekly | SubQ injection | | Weight loss optimization | 7.5-10mg | Once weekly | SubQ injection | | Maximum weight loss | 12.5-15mg | Once weekly | SubQ injection | | Diabetes management (mild) | 5-7.5mg | Once weekly | SubQ injection | | Diabetes management (severe) | 10-15mg | Once weekly | SubQ injection | #### Key Tips - Same day each week, any time of day - With or without food - Rotate injection sites weekly Reconstitution Instructions ## Peptide Interactions #### Semaglutide Avoid Both are GLP-1 agonists—combining increases hypoglycemia and severe GI side effect risk. #### Liraglutide Avoid Another GLP-1 agonist—dual therapy contraindicated due to additive effects. #### Insulin Monitor May require significant insulin dose reduction due to improved sensitivity. #### Metformin Synergistic Complementary mechanisms for diabetes management and weight loss. #### CJC-1295 Compatible Growth hormone support may help preserve muscle mass during weight loss. #### Ipamorelin Compatible May help maintain metabolic rate and muscle preservation. #### BPC-157 Compatible No known interactions, may support gut health and reduce GI effects. #### 5-Amino-1MQ Compatible NNMT inhibition may complement GLP-1 effects for metabolic optimization. ## What to Expect Day 1-3 Appetite reduction begins Week 1-2 Improved blood sugar control (diabetics), mild nausea common Week 2-4 Initial weight loss begins; GI side effects typically improve Ongoing 1-3 lbs weight loss per week during active phase Week 16-24 Peak weight loss effects observed ## Side Effects & Safety #### Common Side Effects - Nausea (mild to moderate, first 2-4 weeks) - Appetite reduction - Possible fatigue during adaptation - Diarrhea or constipation - Reduced food cravings #### Monitoring - Start with lowest dose (2.5mg) and escalate every 4 weeks - May require diabetes medication adjustment to prevent hypoglycemia - Monitor for pancreatitis symptoms #### Stop Signs - Severe/persistent abdominal pain (pancreatitis risk) - Neck lumps, hoarseness, difficulty swallowing (thyroid concerns) - Severe nausea/vomiting preventing adequate nutrition - Severe hypoglycemic signs (confusion, sweating, rapid heartbeat) - Kidney problems (decreased urination, swelling) - Severe allergic reactions (rash, breathing difficulty) - Suicidal thoughts or severe depression - Gallbladder problems (severe upper right pain) - Dehydration from persistent vomiting #### Contraindications - Personal or family history of medullary thyroid carcinoma - Multiple Endocrine Neoplasia syndrome type 2 (MEN2) - Pregnancy or breastfeeding - History of pancreatitis ## Quality Checklist #### Good Signs - White to off-white lyophilized powder without clumping - Clear, colorless reconstituted solution - Intact vial seal with visible mg dosage labeling and batch numbers - Proper storage maintenance at 2-8°C, protected from light #### Warning Signs - Compounded versions without proper quality control #### Bad Signs - Powder clumping, discoloration, or yellow/brown appearance - Persistent cloudiness after reconstitution - Unusual crystallization patterns ## Research & References ### Key References 1. 2022 #### SURMOUNT-1 Phase 3 Trial 15mg weekly achieved 22.5% weight loss vs 2.4% placebo over 72 weeks—largest weight loss in pharmaceutical trials. 2. 2021 #### SURPASS Clinical Program Superior HbA1c reduction and weight loss compared to insulin, semaglutide, and existing diabetes medications. 3. 2023 #### SURMOUNT-2 T2DM Trial 15mg dose achieved 15.7% weight loss with significant cardiometabolic improvements over 72 weeks. 4. 2023 #### SURPASS-CVOT Cardiovascular Outcomes 26% reduction in major adverse cardiovascular events, establishing cardioprotective benefits. [Search PubMed for Tirzepatide](https://pubmed.ncbi.nlm.nih.gov/?term=%28%22Tirzepatide%22%20OR%20%22Mounjaro%22%20OR%20%22Zepbound%22%29) --- *Add `.md` to any page URL on peptidesupermarket.co.za for its Markdown version. Index of the site: https://peptidesupermarket.co.za/llms.txt - full text: https://peptidesupermarket.co.za/llms-full.txt.*