--- title: "Retatrutide Peptide SA - Compare Prices from 29 Suppliers - PeptideSupermarket®" description: "Compare Retatrutide prices from 29 SA suppliers, from R355.00. Find the cheapest deals, read reviews and save money." url: "https://peptidesupermarket.co.za/peptide/retatrutide" site: "PeptideSupermarket®" country: "South Africa" --- [Home](https://peptidesupermarket.co.za) › [Peptides](https://peptidesupermarket.co.za/compare-peptide-prices-za) › Retatrutide Search # Retatrutide Price Comparison Live prices from 29 SA suppliers, from R355.00, compared side by side so you never overpay. [GLP-1 & metabolic research](https://peptidesupermarket.co.za/compare-peptide-prices-za) Prices checked 33 minutes ago We compare prices & may earn a commission. Includes a featured placement — not an endorsement. [Full disclosure](https://peptidesupermarket.co.za/disclosure). Best Price R355.00 Average R1,902.07 Highest R3,863.00 You Could Save 91% 27 results 30mg Compare 27 prices for Retatrutide. Cheapest: R355.00. Average: R1,902.07. | Compare | Supplier | Price | Price / mg | Stock | Delivery | Quality | Coupon | Visit | | --- | --- | --- | --- | --- | --- | --- | --- | --- | | | [Crono Pharm](https://peptidesupermarket.co.za/suppliers/chrono-pharm) Best Retatrutide 30mg | R355.00 | R11.83/mg | In Stock | R150.00 | Lab Tested | — | Visit | | | [TrueForm](https://peptidesupermarket.co.za/suppliers/trueform) Retatrutide 30mg | R1,200.00 | R40.00/mg | In Stock | Free over R4,000 | — | — | Visit | | | [Molon Labs](https://peptidesupermarket.co.za/suppliers/molon-labs) Retatrutide | R1,350.00 | R45.00/mg | In Stock | Free | — | — | Visit | | | [BioHack Peptides](https://peptidesupermarket.co.za/suppliers/biohack-peptides) ★★★★★ 4.9 (88) Retatrutide | R1,450.00 | R48.33/mg | In Stock | Free over R3,000 | Lab Tested | — | Visit | | | [Helix Collective](https://peptidesupermarket.co.za/suppliers/helix-collective) Retatrutide 30mg | R1,500.00 | R50.00/mg | In Stock | R170.00 | — | — | Visit | | | [Grow Nova](https://peptidesupermarket.co.za/suppliers/grow-nova) Retatrutide 30mg | R1,600.00 | R53.33/mg | In Stock | R170.00 | — | — | Visit | | | [Peptera](https://peptidesupermarket.co.za/suppliers/peptera) Retatrutide 30mg | R1,700.00 R1,615.00 | R53.83/mg | In Stock | R185.00 | — | PEPTIDESUPERMARKET05 5% off applied | Visit | | | [White Rabbit Labs](https://peptidesupermarket.co.za/suppliers/white-rabbit-labs) Retatrutide 30mg | R1,750.00 | R58.33/mg | In Stock | R120.00 | — | — | Visit | | | [Striata Labs](https://peptidesupermarket.co.za/suppliers/striata-labs) Retatrutide 30mg | R1,750.00 | R58.33/mg | In Stock | R150.00 | Lab Tested | — | Visit | | | [Peptides HQ](https://peptidesupermarket.co.za/suppliers/peptides-hq) Retatrutide 30mg | R1,800.00 | R60.00/mg | In Stock | R250.00 | Lab Tested | — | Visit | | | [Pure Performance Labs](https://peptidesupermarket.co.za/suppliers/pure-performance-labs) Retatrutide 30mg | R1,838.85 | R61.29/mg | In Stock | R250.00 | Lab Tested | — | Visit | | | [Molon Labs](https://peptidesupermarket.co.za/suppliers/molon-labs) Retatrutide Pen | R1,849.00 | R61.63/mg | In Stock | Free | — | — | Visit | | | [BioHack Peptides](https://peptidesupermarket.co.za/suppliers/biohack-peptides) ★★★★★ 4.9 (88) Retatrutide Pen | R1,850.00 | R61.67/mg | In Stock | Free over R3,000 | Lab Tested | — | Visit | | | [ReGen-X](https://peptidesupermarket.co.za/suppliers/regen-x) Retatrutide 30mg | R1,900.00 | R63.33/mg | In Stock | Free over R1,200 | — | — | Visit | | | [Auraaa](https://peptidesupermarket.co.za/suppliers/auraaa) Retatrutide 30mg | R1,900.00 | R63.33/mg | In Stock | R150.00 | — | — | Visit | | | [White Rabbit Labs](https://peptidesupermarket.co.za/suppliers/white-rabbit-labs) Retatrutide 30mg | R1,950.00 | R65.00/mg | In Stock | R120.00 | — | — | Visit | | | [Chemix Peptides](https://peptidesupermarket.co.za/suppliers/chemix-peptides) Retatrutide 30mg | R1,950.00 | R65.00/mg | In Stock | R250.00 | Lab Tested | — | Visit | | | [Apex Genetics](https://peptidesupermarket.co.za/suppliers/apex-genetics) Retatrutide 30mg | R1,950.00 | R65.00/mg | In Stock | R99.00 | — | — | Visit | | | [Peptide Labs](https://peptidesupermarket.co.za/suppliers/peptide-labs) Retatrutide 30mg | R1,990.00 | R66.33/mg | In Stock | R170.00 | — | — | Visit | | | [Peptera](https://peptidesupermarket.co.za/suppliers/peptera) Retatrutide Pen | R2,100.00 R1,995.00 | R66.50/mg | In Stock | R185.00 | — | PEPTIDESUPERMARKET05 5% off applied | Visit | | | [Health & Fitness ZA](https://peptidesupermarket.co.za/suppliers/health-fitness-za) Retatrutide 30mg | R2,000.00 | R66.67/mg | In Stock | R160.00 | — | — | Visit | | | [Health & Fitness ZA](https://peptidesupermarket.co.za/suppliers/health-fitness-za) Retatrutide 30mg | R2,100.00 | R70.00/mg | In Stock | R160.00 | — | — | Visit | | | [All Peptides](https://peptidesupermarket.co.za/suppliers/all-peptides) Retatrutide 30mg | R2,250.00 | R75.00/mg | In Stock | R100.00 | — | — | Visit | | | [Seranova](https://peptidesupermarket.co.za/suppliers/seranova) Retatrutide 30mg | R2,450.00 | R81.67/mg | In Stock | R250.00 | — | — | Visit | | | [All Peptides](https://peptidesupermarket.co.za/suppliers/all-peptides) Retatrutide Pen | R2,550.00 | R85.00/mg | In Stock | R100.00 | — | — | Visit | Showing 25 of 27 listings Show more suppliers Loading More ways to compare Retatrutide Different views of the same live SA pricing, tuned for how you like to shop. [Best Retatrutide Prices Best prices ranked](https://peptidesupermarket.co.za/best-retatrutide-prices) [Cheapest Retatrutide Prices Cheapest suppliers compared](https://peptidesupermarket.co.za/cheapest-retatrutide-prices) [Where to Buy Retatrutide Full buyer's guide](https://peptidesupermarket.co.za/where-to-buy-retatrutide) [Buy Retatrutide Online SA Cheap Today's hottest deals](https://peptidesupermarket.co.za/buy-retatrutide-online-za-cheap) [Retatrutide Price Comparison Live price dashboard](https://peptidesupermarket.co.za/retatrutide-price-comparison) [Retatrutide SA Supplier Verified SA supplier directory](https://peptidesupermarket.co.za/retatrutide-za-supplier) [Retatrutide For Sale Browse listings for sale](https://peptidesupermarket.co.za/retatrutide-for-sale) Compare another peptide Search PeptideSupermarket® compares prices but doesn't sell products. More All purchases are made directly from third-party suppliers; your relationship is solely with them. We accept no liability for the quality, purity, or legality of any products listed. We may earn a commission when you click through to a supplier and make a purchase. This does not affect pricing information displayed. By using this site you accept responsibility for ensuring purchases comply with applicable laws in your jurisdiction. [Read our full disclosure](https://peptidesupermarket.co.za/disclosure). ## Retatrutide Profile Extensively Studied Triple GLP-1/GIP/Glucagon Agonist | Weight Loss & Diabetes ### Overview Novel triple hormone receptor agonist targeting GLP-1, GIP, and glucagon receptors. Phase II trials demonstrated 24.2% weight loss at 48 weeks—the highest recorded for obesity medications. ### Mechanism of Action Activates GLP-1 for appetite suppression, GIP for insulin sensitivity, and glucagon for increased energy expenditure and hepatic fat oxidation. ### Key Benefits - Superior weight loss (24.2% at 48 weeks) - Improved glycemic control (HbA1c reduction up to 2.16%) - Enhanced cardiovascular benefits - Hepatic fat reduction (up to 82%) - Triple mechanism addresses obesity through multiple pathways ### Quick Stats Typical Dose 0.5mg starting, titrate up to 8-12mg weekly Frequency Once weekly (same day each week) Cycle Duration Continuous therapy as prescribed Storage Reconstituted: 2-8°C, use within 28 days ## Molecular Information Molecular Weight 4,731.33 Da Length 39 amino acids Type Triple GLP-1/GIP/glucagon agonist Half-Life ~6 days ### Amino Acid Sequence One-letter: `HUEGTFTSDVSSYLEGQAAKEFIAWLVRGRGPSSGAPPPS` His 1 Histidine Position 1 Aib 2 Aminoisobutyric Acid Position 2 Glu 3 Glutamic Acid Position 3 Gly 4 Glycine Position 4 Thr 5 Threonine Position 5 Phe 6 Phenylalanine Position 6 Thr 7 Threonine Position 7 Ser 8 Serine Position 8 Asp 9 Aspartic Acid Position 9 Val 10 Valine Position 10 Ser 11 Serine Position 11 Ser 12 Serine Position 12 Tyr 13 Tyrosine Position 13 Leu 14 Leucine Position 14 Glu 15 Glutamic Acid Position 15 Gly 16 Glycine Position 16 Gln 17 Glutamine Position 17 Ala 18 Alanine Position 18 Ala 19 Alanine Position 19 Lys 20 Lysine Position 20 Glu 21 Glutamic Acid Position 21 Phe 22 Phenylalanine Position 22 Ile 23 Isoleucine Position 23 Ala 24 Alanine Position 24 Trp 25 Tryptophan Position 25 Leu 26 Leucine Position 26 Val 27 Valine Position 27 Arg 28 Arginine Position 28 Gly 29 Glycine Position 29 Arg 30 Arginine Position 30 Gly 31 Glycine Position 31 Pro 32 Proline Position 32 Ser 33 Serine Position 33 Ser 34 Serine Position 34 Gly 35 Glycine Position 35 Ala 36 Alanine Position 36 Pro 37 Proline Position 37 Pro 38 Proline Position 38 Pro 39 Proline Position 39 Ser 40 Serine Position 40 N-terminus C-terminus Hydrophobic Polar Positive (+) Negative (-) Modified ### Modifications C20 fatty acid conjugation Aib residues for DPP-4 resistance ## Research Indications The following information is derived from published scientific literature and is provided for educational and research reference purposes only. It does not constitute medical advice, diagnosis, or treatment recommendations. These peptides are not approved for human use and are sold exclusively for in-vitro laboratory research. Weight Loss Type 2 Diabetes Cardiovascular/Metabolic ## Dosing Protocols ### injectable Weekly subcutaneous injection into abdomen, thigh, or upper arm with site rotation. | Goal | Dose | Frequency | Route | | --- | --- | --- | --- | | Starting Dose (Week 1-4) | 0.5mg | Once weekly | SubQ | | Low Maintenance (Week 4-8) | 1mg | Once weekly | SubQ | | Escalation (Week 8-12) | 2mg | Once weekly | SubQ | | Moderate (Week 12-16) | 4mg | Once weekly | SubQ | | Advanced (Week 16-20) | 8mg | Once weekly | SubQ | | Maximum Efficacy (Week 20+) | 12mg | Once weekly | SubQ | #### Key Tips - Once-weekly administration improves compliance - Extended half-life enables consistent hormone regulation - Minimal systemic burden compared to daily dosing Reconstitution Instructions ## Peptide Interactions #### Tirzepatide Avoid Do not combine with other dual/triple agonists—risk of severe hypoglycemia and excessive GI effects. #### Semaglutide Avoid Do not combine—overlapping GLP-1 agonist mechanisms increase severe hypoglycemia risk. #### Cagrilintide Monitor Both cause significant GI effects. Not recommended without specialist supervision. #### Insulin Monitor May significantly reduce insulin requirements. Monitor blood glucose and adjust insulin doses accordingly. #### Metformin Compatible Safe combination tested in clinical trials. Different mechanisms work complementarily for glucose control. #### SGLT2 Inhibitors Compatible Clinical trials included SGLT2 inhibitors with no safety concerns. #### BPC-157 Compatible Safe combination; BPC-157 may provide GI protective benefits during retatrutide use. #### Oral Contraceptives Monitor Space oral contraceptives by 1 hour before retatrutide due to delayed gastric emptying. ## What to Expect Week 1-2 Initial appetite suppression and mild GI effects as body adapts to triple hormone activation Week 2-4 Noticeable food cravings reduction and portion size decrease; early weight loss (2-5%) Week 4-8 Significant appetite control and steady weight loss (5-10%); improved glucose control Week 8-16 Substantial weight reduction (10-18%) with enhanced energy expenditure Week 16-24 Major weight loss milestone (15-22%) with cardiovascular benefits and liver fat reduction Week 24-48 Maximum clinical efficacy (20-24.2%) with comprehensive metabolic improvements ## Side Effects & Safety #### Common Side Effects - Gastrointestinal effects (nausea, vomiting, diarrhea)—typically mild to moderate - Heart rate increases—common especially in first 24 weeks - Appetite suppression - Mild dehydration #### Monitoring - Cardiovascular status (especially heart rate) - Blood glucose if diabetic - Weight loss rate - Signs of pancreatitis - Gastrointestinal tolerability #### Stop Signs - Severe persistent nausea or vomiting preventing adequate nutrition - Signs of pancreatitis: severe abdominal pain radiating to back - Severe hypoglycemia symptoms: confusion, dizziness, sweating - Excessive weight loss (>3 lbs per week consistently or >25% total body weight) - Gallbladder problems: severe right upper abdominal pain #### Contraindications - Personal or family history of medullary thyroid carcinoma - MEN2 syndrome - Severe renal impairment ## Quality Checklist #### Good Signs - Pharmaceutical-grade white powder with uniform texture - Proper cold chain maintenance (2-8°C refrigeration) - Clear, colorless reconstituted solution without particles - Stable extended half-life effects (consistent appetite suppression between doses) #### Warning Signs - Source verification critical—counterfeit versions circulate due to investigational status #### Bad Signs - Rapid tolerance or effectiveness loss suggests degraded or counterfeit product - Unusual side effect profile may indicate contamination ## Research & References ### Key References 1. 2023 #### Phase II Obesity Trial Landmark RCT in 338 participants showing dose-dependent weight loss; 12mg dose achieved 24.2% reduction—highest recorded for any obesity medication. NEJM. 2. 2023 #### Phase II Type 2 Diabetes Study Trial in 281 participants with type 2 diabetes: 16.9% weight loss and HbA1c reductions up to 2.16%. The Lancet. 3. 2024 #### MASLD Substudy Metabolic dysfunction-associated steatotic liver disease study: 82% liver fat reduction with normalization in >90% at highest doses. Nature Medicine. 4. 2024 #### Structural Insights into Triple Agonism Cryo-EM structures reveal simultaneous activation of GLP-1R, GIPR, and GCGR, explaining superior clinical efficacy. Cell Discovery. [Search PubMed for Retatrutide](https://pubmed.ncbi.nlm.nih.gov/?term=%28%22Retatrutide%22%20OR%20%22Retatrutide%20%28GLP-1%2FGIP%2FGlucagon%20receptor%20tri-agonist%29%22%20OR%20%22LY3437943%22%29) Research Library ## Retatrutide research & guides Plain-English guides and study summaries from published literature. [View all 8](https://peptidesupermarket.co.za/research/peptide/retatrutide) ![30mg vs 60mg Retatrutide: what the label actually means](https://peptidesupermarket.co.za/storage/1626/conversions/Reta-PepSupSA-Image-thumbnail.jpg) Guides 7 min ### 30mg vs 60mg Retatrutide: what the label actually means A 60mg Retatrutide product contains twice the stated peptide quantity of a 30mg product, but that does not make it twice as effective or automatically better value. Here is how to read the numbers properly. Read article [30mg vs 60mg Retatrutide: what the label actually means](https://peptidesupermarket.co.za/research/30mg-vs-60mg-retatrutide-what-the-label-actually-means) ![Retatrutide dosing: a minimum effective dose guide for research](https://peptidesupermarket.co.za/storage/1618/conversions/PepSuup-Reta-10mg-thumbnail.jpg) Guides 10 min ### Retatrutide dosing: a minimum effective dose guide for research A research-focused guide to Retatrutide dosing, covering triple agonist effects, slower titration, functional checkpoints and why 12 mg should not be treated as the default target. Read article [Retatrutide dosing: a minimum effective dose guide for research](https://peptidesupermarket.co.za/research/retatrutide-dosing-a-minimum-effective-dose-guide-for-research) ![Retatrutide Prices in South Africa: A Research Guide Beyond Weight Loss](https://peptidesupermarket.co.za/storage/1397/conversions/Retatrutide-Pepsup-image-thumbnail.jpg) Guides 8 min ### Retatrutide Prices in South Africa: A Research Guide Beyond Weight Loss Retatrutide is an investigational GLP-1/GIP/glucagon receptor tri-agonist studied for weight management, glycaemic control, liver fat reduction and wider metabolic outcomes. Read article [Retatrutide Prices in South Africa: A Research Guide Beyond Weight Loss](https://peptidesupermarket.co.za/research/retatrutide-prices-in-south-africa-a-research-guide-beyond-weight-loss) ![Retatrutide South Africa: More Than Weight Loss](https://peptidesupermarket.co.za/storage/1391/conversions/Retatrutide-Pepsup-image-thumbnail.jpg) Guides 8 min ### Retatrutide South Africa: More Than Weight Loss Retatrutide is a triple GLP-1, GIP and glucagon receptor agonist being studied for weight management, glycaemic control, liver fat and wider metabolic health. Read article [Retatrutide South Africa: More Than Weight Loss](https://peptidesupermarket.co.za/research/retatrutide-south-africa-more-than-weight-loss) ![Microdosing Retatrutide: Evidence, Risks and Low-Dose Research](https://peptidesupermarket.co.za/storage/1378/conversions/PepSuup-Reta-10mg-thumbnail.jpg) Guides 7 min ### Microdosing Retatrutide: Evidence, Risks and Low-Dose Research Microdosing Retatrutide is widely discussed, but it is not an established clinical protocol. Here is what low-dose research actually supports, and where the evidence stops. Read article [Microdosing Retatrutide: Evidence, Risks and Low-Dose Research](https://peptidesupermarket.co.za/research/microdosing-retatrutide-evidence-risks-and-low-dose-research) ![Retatrutide South Africa: What the Research Says Beyond Weight Loss](https://peptidesupermarket.co.za/storage/1357/conversions/RETA-Pepsup-image-thumbnail.jpg) Guides 8 min ### Retatrutide South Africa: What the Research Says Beyond Weight Loss Retatrutide is best known for major weight-loss results, but research also examines glucose control, liver fat and cardiometabolic markers. The evidence is promising, with important limits. Read article [Retatrutide South Africa: What the Research Says Beyond Weight Loss](https://peptidesupermarket.co.za/research/retatrutide-south-africa-what-the-research-says-beyond-weight-loss) --- *Add `.md` to any page URL on peptidesupermarket.co.za for its Markdown version. Index of the site: https://peptidesupermarket.co.za/llms.txt - full text: https://peptidesupermarket.co.za/llms-full.txt.*